HORDB

ID: hor004607
Uniprot ID: D4A540
Protein name: Augurin
Gene name: Ecrg4
Organism: Rattus norvegicus (Rat)
Family: Augurin family
Source: Animal
Expression: Decreased expression in the choroid plexus after penetrating injury in the central nervous system. |Expressed in the brain, with expression in the choroid plexus and the ventricular ependymal cells (at protein level).
Disease: NA
Comments: Decreased expression in the choroid plexus after penetrating injury in the central nervous system.
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0007417 central nervous system development; GO:0031145 anaphase-promoting complex-dependent catabolic process; GO:0042127 regulation of cell population proliferation; GO:0070314 G1 to G0 transition; GO:0090398 cellular senescence
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane; GO:0031045 dense core granule

Sequence: QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNQNGHDYYGDYYQRHYDEDAAIGPR
Length: 62(71-132)
Propeptide: MGTSSARPAVLALAGLALLLLLCLGPGDVSGNKLKKMLQKREGPVPSKTNVAVSEHTAKEFLGGLKRAKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNQNGHDYYGDYYQRHYDEDAAIGPRSREGFRHGASVNYDDY
Signal peptide: MGTSSARPAVLALAGLALLLLLCLGPGDVSG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal d
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004607_AF2.pdb

hor004607_ESM.pdb

Mass:	890461	Formula:	C353H484N96O107S
Absent amino acids:	CS	Common amino acids:	DYQ
pI:	4.3	Basic residues:	8
Polar residues:	17	Hydrophobic residues:	15
Hydrophobicity:	-148.23	Boman Index:	-20027
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	39.35
Instability Index:	5271.45	Extinction Coefficient cystines:	28420
Absorbance 280nm:	465.9